Lineage for d5o94a_ (5o94 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2934642Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 2934643Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)
  6. 2934772Protein automated matches [190067] (6 species)
    not a true protein
  7. 2934793Species Streptococcus sp. [TaxId:1306] [186786] (4 PDB entries)
  8. 2934796Domain d5o94a_: 5o94 A: [348900]
    automated match to d2onqa_
    complexed with edo, gol, mpd, na, so4, zn; mutant

Details for d5o94a_

PDB Entry: 5o94 (more details), 1.9 Å

PDB Description: x-ray structure of a zinc binding gb1 mutant
PDB Compounds: (A:) Metal binding GB1

SCOPe Domain Sequences for d5o94a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o94a_ d.15.7.1 (A:) automated matches {Streptococcus sp. [TaxId: 1306]}
mqfklilngktlkgvitieavdhaeaekffkqyandngvdgewtydeathtftvte

SCOPe Domain Coordinates for d5o94a_:

Click to download the PDB-style file with coordinates for d5o94a_.
(The format of our PDB-style files is described here.)

Timeline for d5o94a_: