Lineage for d5yecd_ (5yec D:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2501111Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2502613Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2502614Protein automated matches [190233] (26 species)
    not a true protein
  7. 2502629Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [193300] (8 PDB entries)
  8. 3048790Domain d5yecd_: 5yec D: [348852]
    automated match to d5azha_
    complexed with atp, mg, zn

Details for d5yecd_

PDB Entry: 5yec (more details), 2.15 Å

PDB Description: crystal structure of atg7ctd-atg8-mgatp complex in form ii
PDB Compounds: (D:) Autophagy-related protein 8

SCOPe Domain Sequences for d5yecd_:

Sequence, based on SEQRES records: (download)

>d5yecd_ d.15.1.0 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tfkseypfekrkaeseriadrfpnripvicekaeksdipeidkrkylvpadltvgqfvyv
irkrimlppekaififvndtlpptaalmsaiyqehkdkdgflyvty

Sequence, based on observed residues (ATOM records): (download)

>d5yecd_ d.15.1.0 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tfkseypfekrkaeseriadrfpnripvicekaeksdipeidkrkylvpadltvgqfvyv
irkrimfifvndtlpptaalmsaiyqehkdkdgflyvty

SCOPe Domain Coordinates for d5yecd_:

Click to download the PDB-style file with coordinates for d5yecd_.
(The format of our PDB-style files is described here.)

Timeline for d5yecd_:

  • d5yecd_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-07