Lineage for d5xdxp_ (5xdx P:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2632473Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
    core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest
  4. 2632474Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (2 families) (S)
    automatically mapped to Pfam PF00510
  5. 2632475Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins)
    function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel
  6. 2632488Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species)
  7. 2632489Species Cow (Bos taurus) [TaxId:9913] [81444] (52 PDB entries)
  8. 2632560Domain d5xdxp_: 5xdx P: [348798]
    Other proteins in same PDB: d5xdxa_, d5xdxb1, d5xdxb2, d5xdxd_, d5xdxe_, d5xdxf_, d5xdxg_, d5xdxh_, d5xdxi_, d5xdxj_, d5xdxk_, d5xdxl_, d5xdxm_, d5xdxn_, d5xdxo1, d5xdxo2, d5xdxq_, d5xdxr_, d5xdxs_, d5xdxt_, d5xdxu_, d5xdxv_, d5xdxw_, d5xdxx_, d5xdxy_, d5xdxz_
    automated match to d2occc_
    complexed with cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d5xdxp_

PDB Entry: 5xdx (more details), 1.99 Å

PDB Description: bovine heart cytochrome c oxidase in the reduced state with ph 7.3 at 1.99 angstrom resolution
PDB Compounds: (P:) Cytochrome c oxidase subunit 3

SCOPe Domain Sequences for d5xdxp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xdxp_ f.25.1.1 (P:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]}
hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi
restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih
plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy
eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw
hfvdvvwlflyvsiywwgs

SCOPe Domain Coordinates for d5xdxp_:

Click to download the PDB-style file with coordinates for d5xdxp_.
(The format of our PDB-style files is described here.)

Timeline for d5xdxp_: