Lineage for d5y7ib1 (5y7i B:9-97)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2880095Species Oreochromis mossambicus [TaxId:8127] [348766] (1 PDB entry)
  8. 2880097Domain d5y7ib1: 5y7i B:9-97 [348796]
    Other proteins in same PDB: d5y7ia2, d5y7ib2
    automated match to d2r5ga1

Details for d5y7ib1

PDB Entry: 5y7i (more details), 3 Å

PDB Description: structure of tilapia fish clic2
PDB Compounds: (B:) Chloride intracellular channel protein 2

SCOPe Domain Sequences for d5y7ib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5y7ib1 c.47.1.0 (B:9-97) automated matches {Oreochromis mossambicus [TaxId: 8127]}
dkepsielfikaghdgenvgncpfcqrlfmvlwlkgvkftvttvdmrkkpaelkdlapgt
nppfllyngtlktdfikieefleqtlapp

SCOPe Domain Coordinates for d5y7ib1:

Click to download the PDB-style file with coordinates for d5y7ib1.
(The format of our PDB-style files is described here.)

Timeline for d5y7ib1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5y7ib2