Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 has additional subdomain(s) that are not in the common domain |
Protein Enoyl-ACP reductase [51791] (11 species) |
Species Bacillus cereus [TaxId:226900] [192761] (6 PDB entries) |
Domain d5ycrc_: 5ycr C: [348795] automated match to d2qioa_ complexed with nad, so4 |
PDB Entry: 5ycr (more details), 1.96 Å
SCOPe Domain Sequences for d5ycrc_:
Sequence, based on SEQRES records: (download)
>d5ycrc_ c.2.1.2 (C:) Enoyl-ACP reductase {Bacillus cereus [TaxId: 226900]} mellqgktfvvmgvanqrsiawgiarslhnagakliftyagerlernvreladtlegqes lvlpcdvtndeeltacfetikqevgtihgvahciafanrddlkgefvdtsrdgfllaqni safsltavareakkvmteggniltltylggervvknynvmgvakasleasvkylandlgq hgirvnaisagpirtlsakgvgdfnsilreieeraplrrtttqeevgdtavflfsdlarg vtgenihvdsgyhilg
>d5ycrc_ c.2.1.2 (C:) Enoyl-ACP reductase {Bacillus cereus [TaxId: 226900]} mellqgktfvvmgvanqrsiawgiarslhnagakliftyagerlernvreladtlegqes lvlpcdvtndeeltacfetikqevgtihgvahciafanrddlkgefvdtsrdgfllaqni safsltavareakkvmteggniltltylggervvknynvmgvakasleasvkylandlgq hgirvnaisagpirtgdfnsilreieeraplrrtttqeevgdtavflfsdlargvtgeni hvdsgyhilg
Timeline for d5ycrc_: