SCOPe 2.08: Domain d5ybfb_: 5ybf B:

Lineage for d5ybfb_ (5ybf B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein Glutamate receptor ligand binding core [53881] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [189807] (8 PDB entries)

8. Domain d5ybfb_: 5ybf B: [348790]
   automated match to d2xhda_
   complexed with 8sr, act, glu, zn

Details for d5ybfb_

PDB Entry: 5ybf, 1.5 Å

PDB Description: crystal structure of the glua2o lbd in complex with glutamate and hbt1

PDB Compounds: (B:) Glutamate receptor 2,Glutamate receptor 2

SCOPe Domain Sequences for d5ybfb_:

Sequence; same for both SEQRES and ATOM records:

>d5ybfb_ c.94.1.1 (B:) Glutamate receptor ligand binding core {Human (Homo sapiens) [TaxId: 9606]}
nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
ardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpie
saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslrnavnlavlkln
eqglldklknkwwydkgecg

Timeline for d5ybfb_:

• d5ybfb_ first appeared in SCOPe 2.07