Lineage for d7dfr__ (7dfr -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.71: Dihydrofolate reductases [53596] (1 superfamily) Superfamily c.71.1: Dihydrofolate reductases [53597] (1 family) 
Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins) Protein Dihydrofolate reductase, prokaryotic type [53599] (5 species) Species Escherichia coli [TaxId:562] [53600] (42 PDB entries) 
Domain d7dfr__: 7dfr - [34879]
Details for d7dfr__
PDB Entry: 7dfr (more details), 2.5 Å
PDB Description: crystal structures of escherichia coli dihydrofolate reductase. the nadp+ holoenzyme and the folate(dot)nadp+ ternary complex. substrate binding and a model for the transition state
SCOP Domain Sequences for d7dfr__:
Sequence; same for both SEQRES and ATOM records: (download)
>d7dfr__ c.71.1.1 (-) Dihydrofolate reductase, prokaryotic type {Escherichia coli}
misliaalavdrvigmenampwnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
gdthfpdyepddwesvfsefhdadaqnshsycfeilerr
SCOP Domain Coordinates for d7dfr__:
Click to download the PDB-style file with coordinates for d7dfr__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d7dfr__:
- d7dfr__ appears in SCOP 1.57
- d7dfr__ appears in the current release, SCOPe 2.08, called d7dfra_
View in 3D