SCOPe 2.08: Domain d5y6qa1: 5y6q A:3-82

Lineage for d5y6qa1 (5y6q A:3-82)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.0: automated matches [191632] (1 protein)
   not a true family

6. Protein automated matches [191164] (24 species)
   not a true protein

7. Species Methylobacillus sp. [TaxId:194289] [348742] (1 PDB entry)

8. Domain d5y6qa1: 5y6q A:3-82 [348743]
   Other proteins in same PDB: d5y6qa2
   automated match to d1t3qa2
   complexed with fad, fes, gol, ipa, mcn, mos, sf4, so4

Details for d5y6qa1

PDB Entry: 5y6q, 2.5 Å

PDB Description: crystal structure of an aldehyde oxidase from methylobacillus sp. ky4400

PDB Compounds: (A:) Aldehyde oxidase small subunit

SCOPe Domain Sequences for d5y6qa1:

Sequence; same for both SEQRES and ATOM records:

>d5y6qa1 d.15.4.0 (A:3-82) automated matches {Methylobacillus sp. [TaxId: 194289]}
erisltmqvngqpypmeidprvtlldalrehlnltgtkkgcdqgqcgactvlvngqrvls
cltlaaqadgaevtsieglq

Timeline for d5y6qa1:

• d5y6qa1 first appeared in SCOPe 2.07