SCOPe 2.08: Domain d5y27b1: 5y27 B:1-87

Lineage for d5y27b1 (5y27 B:1-87)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.0: automated matches [238448] (1 protein)
   not a true family

6. Protein automated matches [238450] (4 species)
   not a true protein

7. Species Schizosaccharomyces pombe [TaxId:284812] [348606] (2 PDB entries)

8. Domain d5y27b1: 5y27 B:1-87 [348740]
   Other proteins in same PDB: d5y27b2
   automated match to d5g49b_
   protein/DNA complex; complexed with gol

Details for d5y27b1

PDB Entry: 5y27, 1.9 Å

PDB Description: crystal structure of se-met dpb4-dpb3

PDB Compounds: (B:) Putative transcription factor C16C4.22

SCOPe Domain Sequences for d5y27b1:

Sequence; same for both SEQRES and ATOM records:

>d5y27b1 a.22.1.0 (B:1-87) automated matches {Schizosaccharomyces pombe [TaxId: 284812]}
mektygktvlplsrvkriikqdedvhycsnasallisvatelfveklateayqlaklqkr
kgiryrdvedvvrkddqfeflsdlfsi

Timeline for d5y27b1:

• d5y27b1 first appeared in SCOPe 2.07