Lineage for d5y3xb_ (5y3x B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832343Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2832344Protein automated matches [190075] (132 species)
    not a true protein
  7. 2832492Species Caldicellulosiruptor owensensis [TaxId:632518] [348704] (1 PDB entry)
  8. 2832494Domain d5y3xb_: 5y3x B: [348714]
    automated match to d1n82a_

Details for d5y3xb_

PDB Entry: 5y3x (more details), 2.1 Å

PDB Description: crystal structure of endo-1,4-beta-xylanase from caldicellulosiruptor owensensis
PDB Compounds: (B:) Beta-xylanase

SCOPe Domain Sequences for d5y3xb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5y3xb_ c.1.8.0 (B:) automated matches {Caldicellulosiruptor owensensis [TaxId: 632518]}
ipslaekykeyfkigaavtvkdlegvhgeilvkhfnsltpendmkferihpdehrynfda
vdkmkefaiknnmkmrghtfvwhnqtpewvfkdregndvsrellierlrehiktvcdryr
divyawdvvneavedktekllrdsnwrriigddyikiafeiakeyagegklfyndynnem
pyklektykllkelidketpidgigiqahwniwdknlidnlkraiemyaslgleiqitel
dmsvfefedrrtdllepaeemmelqakvyedvfkvfreykgvitsvtfwgisdkhtwkdn
fpvigrkdwpllfdvngkpkeaffrivnf

SCOPe Domain Coordinates for d5y3xb_:

Click to download the PDB-style file with coordinates for d5y3xb_.
(The format of our PDB-style files is described here.)

Timeline for d5y3xb_: