SCOPe 2.08: Domain d5dfra_: 5dfr A:

Lineage for d5dfra_ (5dfr A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein Dihydrofolate reductase, prokaryotic type [53599] (9 species)

7. Species Escherichia coli [TaxId:562] [53600] (86 PDB entries)

8. Domain d5dfra_: 5dfr A: [34870]
   complexed with cl

Details for d5dfra_

PDB Entry: 5dfr, 2.3 Å

PDB Description: crystal structure of unliganded escherichia coli dihydrofolate reductase. ligand-induced conformational changes and cooperativity in binding

PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d5dfra_:

Sequence, based on SEQRES records:

>d5dfra_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Escherichia coli [TaxId: 562]}
misliaalavdrvigmenampwnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
gdthfpdyepddwesvfsefhdadaqnshsycfeilerr

Sequence, based on observed residues (ATOM records):

>d5dfra_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Escherichia coli [TaxId: 562]}
misliaalavdrvigpwnlpadlawfkrntldkpvimgrhtwesigrplpgrkniilssq
pgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaevegdthf
pdyepddwesvfsefhdadaqnshsycfeilerr

Timeline for d5dfra_:

• d5dfra_ first appeared (with stable ids) in SCOP 1.55, called d5dfr__
  
• d5dfra_ appears in SCOPe 2.07