SCOPe 2.08: Domain d5x86a_: 5x86 A:

Lineage for d5x86a_ (5x86 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:300852] [272710] (21 PDB entries)

8. Domain d5x86a_: 5x86 A: [348696]
   automated match to d3n2ia_
   complexed with cl, mg, tmp

Details for d5x86a_

PDB Entry: 5x86, 1.19 Å

PDB Description: crystal structure of tmp bound thymidylate kinase from thermus thermophilus hb8

PDB Compounds: (A:) thymidylate kinase

SCOPe Domain Sequences for d5x86a_:

Sequence, based on SEQRES records:

>d5x86a_ c.37.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 300852]}
pglfltlegldgsgkttqarrlaafleaqgrpvlltrepggglpevrsllltqelspeae
yllfsadraehvrkvilpglaagkvvisdryldsslayqgygrglplpwlrevareatrg
lkprltflldlppeaalrrvrrpdrleglgleffrrvregylalaraepgrfvvldatlp
eeeiaraiqahlrpllp

Sequence, based on observed residues (ATOM records):

>d5x86a_ c.37.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 300852]}
pglfltlegldgsgkttqarrlaafleaqgrpvlltrepggglpevrsllltqelspeae
yllfsadraehvrkvilpglaagkvvisdryldsslayqgygrglplpwlrevareatrg
lkprltflldlppeaaleglgleffrrvregylalaraepgrfvvldatlpeeeiaraiq
ahlrpllp

Timeline for d5x86a_:

• d5x86a_ first appeared in SCOPe 2.07