![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.9: Ubiquitin carboxyl-terminal hydrolase, UCH [82568] (6 proteins) Pfam PF00443 |
![]() | Protein automated matches [191167] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189384] (6 PDB entries) |
![]() | Domain d5xu8a_: 5xu8 A: [348692] Other proteins in same PDB: d5xu8b_ automated match to d3nhea_ complexed with cl, dx4, na, zn |
PDB Entry: 5xu8 (more details), 1.81 Å
SCOPe Domain Sequences for d5xu8a_:
Sequence, based on SEQRES records: (download)
>d5xu8a_ d.3.1.9 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qglaglrnlgntcfmnsilqclsntrelrdyclqrlymrdlhhgsnahtalveefakliq tiwtsspndvvspsefktqiqryaprfvgynqqdaqeflrflldglhnevnrvtlrpksn penldhlpddekgrqmwrkyleredsrigdlfvgqlkssltctdcgycstvfdpfwdlsl piakrgypevtlmdcmrlftkedvldgdekptccrcrgrkrcikkfsiqrfpkilvlhlk rfsesrirtsklttfvnfplrdldlrefasentnhavynlyavsnhsgttmgghytaycr spgtgewhtfndssvtpmsssqvrtsdayllfyela
>d5xu8a_ d.3.1.9 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qglaglrnlgntcfmnsilqclsntrelrdyclqrlymrdlhhgsnahtalveefakliq tiwtsspndvvspsefktqiqryaprfvgynqqdaqeflrflldglhnevnrvnldhlpd dekgrqmwrkyleredsrigdlfvgqlkssltctdcgycstvfdpfwdlslpiakrgype vtlmdcmrlftkedvldgdekptccrcrgrkrcikkfsiqrfpkilvlhlkrfsesrirt sklttfvnfplrdldlrefasentnhavynlyavsnhsgttmgghytaycrspgtgewht fndssvtpmsssqvrtsdayllfyela
Timeline for d5xu8a_: