Lineage for d5y3qa1 (5y3q A:1-62)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2501111Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2502613Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2502614Protein automated matches [190233] (26 species)
    not a true protein
  7. 2502796Species Human sars coronavirus [TaxId:227859] [333835] (3 PDB entries)
  8. 3048613Domain d5y3qa1: 5y3q A:1-62 [348675]
    Other proteins in same PDB: d5y3qa2, d5y3qa3
    automated match to d5tl6b1
    complexed with bme, gol, na, zn

Details for d5y3qa1

PDB Entry: 5y3q (more details), 1.65 Å

PDB Description: crystal structure of sars coronavirus papain-like protease conjugated with beta-mercaptoethanol
PDB Compounds: (A:) Replicase polyprotein 1a

SCOPe Domain Sequences for d5y3qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5y3qa1 d.15.1.0 (A:1-62) automated matches {Human sars coronavirus [TaxId: 227859]}
mevktikvfttvdntnlhtqlvdmsmtygqqfgptyldgadvtkikphvnhegktffvlp
sd

SCOPe Domain Coordinates for d5y3qa1:

Click to download the PDB-style file with coordinates for d5y3qa1.
(The format of our PDB-style files is described here.)

Timeline for d5y3qa1:

  • d5y3qa1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-07