SCOPe 2.07: Domain d5xdxk_: 5xdx K:

Lineage for d5xdxk_ (5xdx K:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.5: Mitochondrial cytochrome c oxidase subunit VIIb [81423] (1 family)
   automatically mapped to Pfam PF05392

5. Family f.23.5.1: Mitochondrial cytochrome c oxidase subunit VIIb [81422] (2 proteins)

6. Protein Mitochondrial cytochrome c oxidase subunit VIIb [81421] (1 species)
   function unknown, probably acts as a regulator or is required for the assembly

7. Species Cow (Bos taurus) [TaxId:9913] [81420] (29 PDB entries)

8. Domain d5xdxk_: 5xdx K: [348639]
   Other proteins in same PDB: d5xdxa_, d5xdxb1, d5xdxb2, d5xdxc_, d5xdxd_, d5xdxe_, d5xdxf_, d5xdxg_, d5xdxh_, d5xdxi_, d5xdxj_, d5xdxl_, d5xdxm_, d5xdxn_, d5xdxo1, d5xdxo2, d5xdxp_, d5xdxq_, d5xdxr_, d5xdxs_, d5xdxt_, d5xdxu_, d5xdxv_, d5xdxw_, d5xdxy_, d5xdxz_
   automated match to d1v54k_
   complexed with cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d5xdxk_

PDB Entry: 5xdx, 1.99 Å

PDB Description: bovine heart cytochrome c oxidase in the reduced state with ph 7.3 at 1.99 angstrom resolution

PDB Compounds: (K:) Cytochrome c oxidase subunit VIIb

SCOPe Domain Sequences for d5xdxk_:

Sequence; same for both SEQRES and ATOM records:

>d5xdxk_ f.23.5.1 (K:) Mitochondrial cytochrome c oxidase subunit VIIb {Cow (Bos taurus) [TaxId: 9913]}
apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr

Timeline for d5xdxk_:

• d5xdxk_ is new in SCOPe 2.07-stable
  
• d5xdxk_ appears in the current release, SCOPe 2.08