Lineage for d5xm3d_ (5xm3 D:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. Superfamily a.137.2: Methanol dehydrogenase subunit [48666] (1 family) (S)
    consists of single alpha-helix and irregular N-terminal tail
    automatically mapped to Pfam PF02315
  5. Family a.137.2.1: Methanol dehydrogenase subunit [48667] (2 proteins)
  6. Protein automated matches [190583] (3 species)
    not a true protein
  7. Species Methylophaga aminisulfidivorans [TaxId:1026882] [348593] (1 PDB entry)
  8. Domain d5xm3d_: 5xm3 D: [348594]
    Other proteins in same PDB: d5xm3a_, d5xm3c_
    automated match to d1w6sb_
    complexed with mg, pqq

Details for d5xm3d_

PDB Entry: 5xm3 (more details), 1.7000000000000002 Å

PDB Description: crystal structure of methanol dehydrogenase from methylophaga aminisulfidivorans
PDB Compounds: (D:) Methanol dehydrogenase [cytochrome c] subunit 2

SCOPe Domain Sequences for d5xm3d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xm3d_ a.137.2.1 (D:) automated matches {Methylophaga aminisulfidivorans [TaxId: 1026882]}
ydgtkckaagdcweakpgfpdkikgskydpkhsekelnkqdaalkamekrnaerveqfkk
tgkwvy

SCOPe Domain Coordinates for d5xm3d_ are not available.

Timeline for d5xm3d_:

Domains from other chains:
(mouse over for more information)
d5xm3a_, d5xm3b_, d5xm3c_