Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
Domain d5wnad2: 5wna D:107-211 [348588] Other proteins in same PDB: d5wnac_, d5wnah_ automated match to d5mvzb2 |
PDB Entry: 5wna (more details), 2.4 Å
SCOPe Domain Sequences for d5wnad2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wnad2 b.1.1.0 (D:107-211) automated matches {Human (Homo sapiens) [TaxId: 9606]} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg
Timeline for d5wnad2:
View in 3D Domains from other chains: (mouse over for more information) d5wnac_, d5wnah_, d5wnal1, d5wnal2 |