SCOPe 2.08: Domain d5wnad2: 5wna D:107-211

Lineage for d5wnad2 (5wna D:107-211)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5wnad2: 5wna D:107-211 [348588]
   Other proteins in same PDB: d5wnac_, d5wnah_
   automated match to d5mvzb2

Details for d5wnad2

PDB Entry: 5wna, 2.4 Å

PDB Description: structure of antibody 3d3 bound to the central conserved region of rsv g

PDB Compounds: (D:) mAb 3D3 Fab light chain

SCOPe Domain Sequences for d5wnad2:

Sequence; same for both SEQRES and ATOM records:

>d5wnad2 b.1.1.0 (D:107-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Timeline for d5wnad2:

• d5wnad2 first appeared in SCOPe 2.07