SCOPe 2.08: Domain d5xrja1: 5xrj A:3-139

Lineage for d5xrja1 (5xrj A:3-139)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)

6. Protein automated matches [190029] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186749] (38 PDB entries)

8. Domain d5xrja1: 5xrj A:3-139 [348574]
   Other proteins in same PDB: d5xrja2
   automated match to d1g86a_

Details for d5xrja1

PDB Entry: 5xrj, 1.9 Å

PDB Description: galectin-10/charcot-leyden crystal protein variant h53a crystal structure

PDB Compounds: (A:) Galectin-10

SCOPe Domain Sequences for d5xrja1:

Sequence; same for both SEQRES and ATOM records:

>d5xrja1 b.29.1.3 (A:3-139) automated matches {Human (Homo sapiens) [TaxId: 9606]}
llpvpyteaaslstgstvtikgrplacflnepylqvdfhtemkeesdivfafqvcfgrrv
vmnsreygawkqqvesknmpfqdgqefelsisvlpdkyqvmvngqssytfdhrikpeavk
mvqvwrdisltkfnvsy

Timeline for d5xrja1:

• d5xrja1 first appeared in SCOPe 2.07, called d5xrja_