SCOPe 2.08: Domain d5ocjb_: 5ocj B:

Lineage for d5ocjb_ (5ocj B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.3: Mycobacterial antigens [53491] (5 proteins)
   automatically mapped to Pfam PF00756

6. Protein automated matches [227016] (2 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [258342] (8 PDB entries)

8. Domain d5ocjb_: 5ocj B: [348572]
   automated match to d1sfra_
   complexed with 9sw, dms

Details for d5ocjb_

PDB Entry: 5ocj, 1.8 Å

PDB Description: crystal structure of ag85c bound to cyclophostin 8beta inhibitor

PDB Compounds: (B:) Diacylglycerol acyltransferase/mycolyltransferase Ag85C

SCOPe Domain Sequences for d5ocjb_:

Sequence; same for both SEQRES and ATOM records:

>d5ocjb_ c.69.1.3 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
lpveylqvpsasmgrdikvqfqgggphavylldglraqddyngwdintpafeeyyqsgls
vimpvggqssfytdwyqpsqsngqnytykwetfltrempawlqankgvsptgnaavglsm
sggsalilaayypqqfpyaaslsgflnpsegwwptliglamndsggynansmwgpssdpa
wkrndpmvqiprlvanntriwvycgngtpsdlggdnipakflegltlrtnqtfrdtyaad
ggrngvfnfppngthswpywneqlvamkadiqhvlng

Timeline for d5ocjb_:

• d5ocjb_ first appeared in SCOPe 2.07