SCOPe 2.07: Domain d5xdxl_: 5xdx L:

Lineage for d5xdxl_ (5xdx L:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.6: Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81427] (1 family)
   automatically mapped to Pfam PF02935

5. Family f.23.6.1: Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81426] (2 proteins)

6. Protein Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81425] (1 species)
   function unknown, probably acts as a regulator or is required for the assembly

7. Species Cow (Bos taurus) [TaxId:9913] [81424] (49 PDB entries)

8. Domain d5xdxl_: 5xdx L: [348562]
   Other proteins in same PDB: d5xdxa_, d5xdxb1, d5xdxb2, d5xdxc_, d5xdxd_, d5xdxe_, d5xdxf_, d5xdxg_, d5xdxh_, d5xdxi_, d5xdxj_, d5xdxk_, d5xdxm_, d5xdxn_, d5xdxo1, d5xdxo2, d5xdxp_, d5xdxq_, d5xdxr_, d5xdxs_, d5xdxt_, d5xdxu_, d5xdxv_, d5xdxw_, d5xdxx_, d5xdxz_
   automated match to d1v54l_
   complexed with cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d5xdxl_

PDB Entry: 5xdx, 1.99 Å

PDB Description: bovine heart cytochrome c oxidase in the reduced state with ph 7.3 at 1.99 angstrom resolution

PDB Compounds: (L:) Cytochrome c oxidase subunit VIIc

SCOPe Domain Sequences for d5xdxl_:

Sequence; same for both SEQRES and ATOM records:

>d5xdxl_ f.23.6.1 (L:) Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) {Cow (Bos taurus) [TaxId: 9913]}
hyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk

Timeline for d5xdxl_:

• d5xdxl_ is new in SCOPe 2.07-stable
  
• d5xdxl_ appears in the current release, SCOPe 2.08