Lineage for d5xm3c_ (5xm3 C:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2399926Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 2399927Superfamily b.70.1: Quinoprotein alcohol dehydrogenase-like [50998] (2 families) (S)
  5. 2399928Family b.70.1.1: Quinoprotein alcohol dehydrogenase-like [50999] (4 proteins)
  6. 2399966Protein automated matches [190582] (3 species)
    not a true protein
  7. 3048495Species Methylophaga aminisulfidivorans [TaxId:1026882] [348557] (1 PDB entry)
  8. 3048496Domain d5xm3c_: 5xm3 C: [348558]
    Other proteins in same PDB: d5xm3b_, d5xm3d_
    automated match to d1w6sa_
    complexed with mg, pqq

Details for d5xm3c_

PDB Entry: 5xm3 (more details), 1.7 Å

PDB Description: crystal structure of methanol dehydrogenase from methylophaga aminisulfidivorans
PDB Compounds: (C:) glucose dehydrogenase

SCOPe Domain Sequences for d5xm3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xm3c_ b.70.1.1 (C:) automated matches {Methylophaga aminisulfidivorans [TaxId: 1026882]}
ndklvelsksnenwvmqgkdfsgthystakqinkdnvkklrpswsfstgvlnghegaplv
vngtmyihtpfpnntfaidldepgvikwehkpkqdpaaravaccdvvnrglaywpgddka
pamivkslldghvvalnaetgeeywkvengdisvgqtetaapfvakdlviqgssgaelgv
rgyvtaydihtgemvwrwyatgpdadvgldkdfnkhnphygqkglgtstwednawkiggg
tnwgwyaydpqldmfyygsgnpapwnetmrpgdnkwtmtiwgrdletglakfgyqktphd
ewdyagvnvmmlseqkdkngkmrkllthpdrngiiytldretgdlvsankmddtanwvkk
vdletglpirdpeygtrmghrsrdvcpsamgfhnqgfdsydpkrelfylginhlcmdwep
fmlpyragqffvganvwtypgpkgdrqngigsgqvkaynaitgefawekmekfsvwggtt
ategglvfygtldgfikardadtgkllwkfklpsgvighpmtythkgtqyvainygvggw
pavglvfdlndpsaglgavgafkelakntqmgggvmvfsldgkspyddvslgeygm

SCOPe Domain Coordinates for d5xm3c_:

Click to download the PDB-style file with coordinates for d5xm3c_.
(The format of our PDB-style files is described here.)

Timeline for d5xm3c_:

  • d5xm3c_ is new in SCOPe 2.07-stable