Lineage for d5xm0d_ (5xm0 D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2698056Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2698677Protein automated matches [193445] (8 species)
    not a true protein
  7. 2699055Species Mouse (Mus musculus) [TaxId:10090] [254907] (4 PDB entries)
  8. 2699075Domain d5xm0d_: 5xm0 D: [348541]
    automated match to d1kx5d_
    protein/DNA complex

Details for d5xm0d_

PDB Entry: 5xm0 (more details), 2.87 Å

PDB Description: the mouse nucleosome structure containing h2a, h2b type3-a, h3.3, and h4
PDB Compounds: (D:) Histone H2B type 3-A

SCOPe Domain Sequences for d5xm0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xm0d_ a.22.1.1 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rgrkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiaseasrlahynkrstit
srevqtavrlllpgelakhavsegtkavtkytss

SCOPe Domain Coordinates for d5xm0d_:

Click to download the PDB-style file with coordinates for d5xm0d_.
(The format of our PDB-style files is described here.)

Timeline for d5xm0d_: