Lineage for d5x5xl2 (5x5x L:109-211)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (25 species)
    not a true protein
  7. 2357727Species Mouse (Mus musculus) [TaxId:10090] [188198] (670 PDB entries)
  8. 3048473Domain d5x5xl2: 5x5x L:109-211 [348535]
    Other proteins in same PDB: d5x5xl1
    automated match to d1mrdl2
    complexed with fmt, peg, pg4, pge

Details for d5x5xl2

PDB Entry: 5x5x (more details), 1.9 Å

PDB Description: crystal structure of the fab fragment of anti-osteocalcin c-terminal peptide antibody ktm219
PDB Compounds: (L:) L chain of anti-osteocalcin antibody KTM219

SCOPe Domain Sequences for d5x5xl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x5xl2 b.1.1.0 (L:109-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
adaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqds
kdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

SCOPe Domain Coordinates for d5x5xl2:

Click to download the PDB-style file with coordinates for d5x5xl2.
(The format of our PDB-style files is described here.)

Timeline for d5x5xl2:

  • d5x5xl2 appears in periodic updates to SCOPe 2.07 starting on 2018-04-07