SCOPe 2.08: Domain d5x5xl2: 5x5x L:109-211

Lineage for d5x5xl2 (5x5x L:109-211)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d5x5xl2: 5x5x L:109-211 [348535]
   Other proteins in same PDB: d5x5xl1
   automated match to d1mrdl2
   complexed with fmt, peg, pg4, pge

Details for d5x5xl2

PDB Entry: 5x5x, 1.9 Å

PDB Description: crystal structure of the fab fragment of anti-osteocalcin c-terminal peptide antibody ktm219

PDB Compounds: (L:) L chain of anti-osteocalcin antibody KTM219

SCOPe Domain Sequences for d5x5xl2:

Sequence; same for both SEQRES and ATOM records:

>d5x5xl2 b.1.1.0 (L:109-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
adaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqds
kdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d5x5xl2:

• d5x5xl2 first appeared in SCOPe 2.07