Lineage for d1rx9__ (1rx9 -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.71: Dihydrofolate reductases [53596] (1 superfamily) Superfamily c.71.1: Dihydrofolate reductases [53597] (1 family) 
Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins) Protein Dihydrofolate reductase, prokaryotic type [53599] (5 species) Species Escherichia coli [TaxId:562] [53600] (42 PDB entries) 
Domain d1rx9__: 1rx9 - [34851]
Details for d1rx9__
PDB Entry: 1rx9 (more details), 1.9 Å
PDB Description: dihydrofolate reductase (e.c.1.5.1.3) complexed with nicotinamide adenine dinucleotide phosphate (oxidized form)
SCOP Domain Sequences for d1rx9__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rx9__ c.71.1.1 (-) Dihydrofolate reductase, prokaryotic type {Escherichia coli}
misliaalavdrvigmenampwnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
gdthfpdyepddwesvfsefhdadaqnshsycfeilerr
SCOP Domain Coordinates for d1rx9__:
Click to download the PDB-style file with coordinates for d1rx9__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rx9__:
- d1rx9__ appears in SCOP 1.57
- d1rx9__ appears in the current release, SCOPe 2.08, called d1rx9a_
View in 3D