Class g: Small proteins [56992] (98 folds) |
Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.5: Rubredoxin-like [57802] (4 families) |
Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (2 proteins) membrane-anchored rubredoxin-like domain automatically mapped to Pfam PF01215 |
Protein automated matches [254652] (1 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [255694] (3 PDB entries) |
Domain d5xdxs_: 5xdx S: [348509] Other proteins in same PDB: d5xdxa_, d5xdxb1, d5xdxb2, d5xdxc_, d5xdxd_, d5xdxe_, d5xdxg_, d5xdxh_, d5xdxi_, d5xdxj_, d5xdxk_, d5xdxl_, d5xdxm_, d5xdxn_, d5xdxo1, d5xdxo2, d5xdxp_, d5xdxq_, d5xdxr_, d5xdxt_, d5xdxu_, d5xdxv_, d5xdxw_, d5xdxx_, d5xdxy_, d5xdxz_ automated match to d3ag3f_ complexed with cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, zn |
PDB Entry: 5xdx (more details), 1.99 Å
SCOPe Domain Sequences for d5xdxs_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xdxs_ g.41.5.3 (S:) automated matches {Cow (Bos taurus) [TaxId: 9913]} asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc iceednstviwfwlhkgeaqrcpscgthyklvph
Timeline for d5xdxs_:
View in 3D Domains from other chains: (mouse over for more information) d5xdxa_, d5xdxb1, d5xdxb2, d5xdxc_, d5xdxd_, d5xdxe_, d5xdxf_, d5xdxg_, d5xdxh_, d5xdxi_, d5xdxj_, d5xdxk_, d5xdxl_, d5xdxm_, d5xdxn_, d5xdxo1, d5xdxo2, d5xdxp_, d5xdxq_, d5xdxr_, d5xdxt_, d5xdxu_, d5xdxv_, d5xdxw_, d5xdxx_, d5xdxy_, d5xdxz_ |