| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.1: Ferritin [47241] (10 proteins) |
| Protein Bacterioferritin (cytochrome b1) [47244] (6 species) binds heme between two subunits; 24-mer |
| Species Escherichia coli K-12 [TaxId:83333] [188868] (9 PDB entries) |
| Domain d5xgoa_: 5xgo A: [348489] automated match to d1veia_ complexed with cl |
PDB Entry: 5xgo (more details), 1.99 Å
SCOPe Domain Sequences for d5xgoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xgoa_ a.25.1.1 (A:) Bacterioferritin (cytochrome b1) {Escherichia coli K-12 [TaxId: 83333]}
llytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrtal
idhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandvr
kaigeakdddtadiltaasrdldkflwfiecnldl
Timeline for d5xgoa_: