Lineage for d5x2bi_ (5x2b I:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2451887Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2451888Protein automated matches [190123] (144 species)
    not a true protein
  7. 2452594Species Mouse (Mus musculus) [TaxId:10090] [186847] (11 PDB entries)
  8. 3048401Domain d5x2bi_: 5x2b I: [348463]
    Other proteins in same PDB: d5x2bc2, d5x2bd2, d5x2bf2, d5x2bh2, d5x2bl2, d5x2bl3
    automated match to d1j99a_
    complexed with a3p, ca, gol

Details for d5x2bi_

PDB Entry: 5x2b (more details), 2.08 Å

PDB Description: crystal structure of mouse sulfotransferase sult7a1 complexed with pap
PDB Compounds: (I:) sulfotransferase

SCOPe Domain Sequences for d5x2bi_:

Sequence, based on SEQRES records: (download)

>d5x2bi_ c.37.1.0 (I:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
llhkymgiffstmsseellgsldsfdareddiflvsypksgthwlaevieripdagitlt
spielgdiskfeelkripkrraipthlnyemlpvtvkqkqckiiyivrnpkdtavsmfhy
yrdnpnlpstetwaaflelflkgdvvygswfdhvlsweehkndknvlfifyeemkkdfvk
slkkitaflgidvndsemakiarstsfsemksnaakencdpnhvicaltsdrnlvfrkgv
vgdwinyftpkqnrgfdelftekmrnsdvgrclkeyah

Sequence, based on observed residues (ATOM records): (download)

>d5x2bi_ c.37.1.0 (I:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
llhkymgiffstmsseellgsldsfdareddiflvsypksgthwlaevieripdagitlt
spielgdiskfeelkripkrraipthlnyemlpvtvkqkqckiiyivrnpkdtavsmfhy
yrdnpnlpstetwaaflelflkgdvvygswfdhvlsweehkndknvlfifyeemkkdfvk
slkkitaflgidvndsemakiarstsfsemksnaakncdpnhvicaltsdrnlvfrkgvv
gdwinyftpkqnrgfdelftekmrnsdvgrclkeyah

SCOPe Domain Coordinates for d5x2bi_:

Click to download the PDB-style file with coordinates for d5x2bi_.
(The format of our PDB-style files is described here.)

Timeline for d5x2bi_:

  • d5x2bi_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-07