Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies) two antiparallel transmembrane helices |
Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) |
Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins) |
Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [81454] (45 PDB entries) |
Domain d5xdxo1: 5xdx O:1-90 [348459] Other proteins in same PDB: d5xdxa_, d5xdxb2, d5xdxc_, d5xdxd_, d5xdxe_, d5xdxf_, d5xdxg_, d5xdxh_, d5xdxi_, d5xdxj_, d5xdxk_, d5xdxl_, d5xdxm_, d5xdxn_, d5xdxo2, d5xdxp_, d5xdxq_, d5xdxr_, d5xdxs_, d5xdxt_, d5xdxu_, d5xdxv_, d5xdxw_, d5xdxx_, d5xdxy_, d5xdxz_ automated match to d1v54b2 complexed with cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, zn |
PDB Entry: 5xdx (more details), 1.99 Å
SCOPe Domain Sequences for d5xdxo1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xdxo1 f.17.2.1 (O:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]} maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe vetiwtilpaiililialpslrilymmdei
Timeline for d5xdxo1:
View in 3D Domains from other chains: (mouse over for more information) d5xdxa_, d5xdxb1, d5xdxb2, d5xdxc_, d5xdxd_, d5xdxe_, d5xdxf_, d5xdxg_, d5xdxh_, d5xdxi_, d5xdxj_, d5xdxk_, d5xdxl_, d5xdxm_, d5xdxn_, d5xdxp_, d5xdxq_, d5xdxr_, d5xdxs_, d5xdxt_, d5xdxu_, d5xdxv_, d5xdxw_, d5xdxx_, d5xdxy_, d5xdxz_ |