Lineage for d5vztc2 (5vzt C:1083-1163)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2341036Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
    multihelical; interlocked heterodimer with F-box proteins
  4. 2341037Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families) (S)
    automatically mapped to Pfam PF01466
  5. 2341038Family a.157.1.1: Skp1 dimerisation domain-like [81380] (3 proteins)
  6. 2341065Protein automated matches [226933] (1 species)
    not a true protein
  7. 2341066Species Human (Homo sapiens) [TaxId:9606] [225235] (11 PDB entries)
  8. 3048288Domain d5vztc2: 5vzt C:1083-1163 [348350]
    Other proteins in same PDB: d5vzta1, d5vztc1
    automated match to d3wsob2
    complexed with dtt, po4, zn

Details for d5vztc2

PDB Entry: 5vzt (more details), 2.7 Å

PDB Description: crystal structure of the skp1-fbxo31 complex
PDB Compounds: (C:) S-phase kinase-associated protein 1

SCOPe Domain Sequences for d5vztc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vztc2 a.157.1.1 (C:1083-1163) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfnik
ndfteeeeaqvrkenqwceek

SCOPe Domain Coordinates for d5vztc2:

Click to download the PDB-style file with coordinates for d5vztc2.
(The format of our PDB-style files is described here.)

Timeline for d5vztc2:

  • d5vztc2 appears in periodic updates to SCOPe 2.07 starting on 2018-04-06

View in 3D
Domains from same chain:
(mouse over for more information)
d5vztc1