Lineage for d5vztc1 (5vzt C:1002-1069)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2513276Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2513277Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2513558Family d.42.1.0: automated matches [191460] (1 protein)
    not a true family
  6. 2513559Protein automated matches [190710] (4 species)
    not a true protein
  7. 2513560Species Human (Homo sapiens) [TaxId:9606] [187857] (47 PDB entries)
  8. 3048287Domain d5vztc1: 5vzt C:1002-1069 [348349]
    Other proteins in same PDB: d5vzta2, d5vztc2
    automated match to d3wsob1
    complexed with dtt, po4, zn

Details for d5vztc1

PDB Entry: 5vzt (more details), 2.7 Å

PDB Description: crystal structure of the skp1-fbxo31 complex
PDB Compounds: (C:) S-phase kinase-associated protein 1

SCOPe Domain Sequences for d5vztc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vztc1 d.42.1.0 (C:1002-1069) automated matches {Human (Homo sapiens) [TaxId: 9606]}
asiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhkd
dp

SCOPe Domain Coordinates for d5vztc1:

Click to download the PDB-style file with coordinates for d5vztc1.
(The format of our PDB-style files is described here.)

Timeline for d5vztc1:

  • d5vztc1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-06

View in 3D
Domains from same chain:
(mouse over for more information)
d5vztc2