SCOPe 2.08: Domain d5wkcb1: 5wkc B:83-269

Lineage for d5wkcb1 (5wkc B:83-269)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins)
   the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology
   automatically mapped to Pfam PF02776

6. Protein Acetohydroxyacid synthase catalytic subunit [88733] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [314106] (3 PDB entries)

8. Domain d5wkcb1: 5wkc B:83-269 [348346]
   Other proteins in same PDB: d5wkca2, d5wkca3, d5wkcb2, d5wkcb3, d5wkcd2, d5wkcd3, d5wkce2, d5wkce3
   automated match to d1n0ha2
   complexed with auj, f50, fad, mg, pxd, tp9

Details for d5wkcb1

PDB Entry: 5wkc, 2.33 Å

PDB Description: saccharomyces cerevisiae acetohydroxyacid synthase in complex with the herbicide penoxsulam

PDB Compounds: (B:) Acetolactate synthase catalytic subunit, mitochondrial

SCOPe Domain Sequences for d5wkcb1:

Sequence; same for both SEQRES and ATOM records:

>d5wkcb1 c.36.1.5 (B:83-269) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
pdmdtsfvgltggqifnemmsrqnvdtvfgypggailpvydaihnsdkfnfvlpkheqga
ghmaegyarasgkpgvvlvtsgpgatnvvtpmadafadgipmvvftgqvptsaigtdafq
eadvvgisrsctkwnvmvksveelplrineafeiatsgrpgpvlvdlpkdvtaailrnpi
ptkttlp

Timeline for d5wkcb1:

• d5wkcb1 first appeared in SCOPe 2.07