SCOPe 2.07: Domain d5wzed2: 5wze D:177-444

Lineage for d5wzed2 (5wze D:177-444)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
   duplication: composed of two very similar alpha+beta folds

4. Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families)

5. Family d.127.1.0: automated matches [194833] (1 protein)
   not a true family

6. Protein automated matches [194834] (4 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:208964] [348286] (1 PDB entry)

8. Domain d5wzed2: 5wze D:177-444 [348336]
   Other proteins in same PDB: d5wzea1, d5wzec1, d5wzed1
   automated match to d1wl9a2
   complexed with ala, ca, edo, gol, mn, na, pge, pro, so4

Details for d5wzed2

PDB Entry: 5wze, 1.78 Å

PDB Description: the structure of pseudomonas aeruginosa aminopeptidase pepp

PDB Compounds: (D:) aminopeptidase p

SCOPe Domain Sequences for d5wzed2:

Sequence; same for both SEQRES and ATOM records:

>d5wzed2 d.127.1.0 (D:177-444) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
sanevkvmryaaevsarahiramevcrpglfeyhleaeleyefrkggakmpaygsivaag
rnacilhyrendaaikdgdlilidagceidcyasditrtfpangrfspeqkaiyelvlea
nmaafdyiapgrhwneaheatvrvitaglvrlgllegdvdeliaheaykafymhraghwl
gmdvhdvgeyrvggewrvlepgmamtvepgiyiapdnttvakkwrgigvrieddvvvtrn
gcevltngvpktvaeiealmaaakseaa

Timeline for d5wzed2:

• d5wzed2 is new in SCOPe 2.07-stable
  
• d5wzed2 appears in the current release, SCOPe 2.08