Lineage for d5wzed1 (5wze D:1-176)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885765Superfamily c.55.2: Creatinase/prolidase N-terminal domain [53092] (2 families) (S)
  5. 2885824Family c.55.2.0: automated matches [238315] (1 protein)
    not a true family
  6. 2885825Protein automated matches [238316] (2 species)
    not a true protein
  7. 2885826Species Pseudomonas aeruginosa [TaxId:208964] [348284] (1 PDB entry)
  8. 2885829Domain d5wzed1: 5wze D:1-176 [348335]
    Other proteins in same PDB: d5wzea2, d5wzec2, d5wzed2
    automated match to d2v3za1
    complexed with ala, ca, edo, gol, mn, na, pge, pro, so4

Details for d5wzed1

PDB Entry: 5wze (more details), 1.78 Å

PDB Description: the structure of pseudomonas aeruginosa aminopeptidase pepp
PDB Compounds: (D:) aminopeptidase p

SCOPe Domain Sequences for d5wzed1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wzed1 c.55.2.0 (D:1-176) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
miripkseyarrrkalmaqmepnsiailpaapmyirnrdvehvyrqdsdfqyltgfpepe
avmalipgrahgeyvlfcrerdperelwdglragqdgaigqygaddafpigdiddilpgl
iegrdrvyyalganpdfdrrlmdwinvirskarqgaqppnefvaldhllhdqrlyk

SCOPe Domain Coordinates for d5wzed1:

Click to download the PDB-style file with coordinates for d5wzed1.
(The format of our PDB-style files is described here.)

Timeline for d5wzed1: