Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (71 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:208964] [348264] (5 PDB entries) |
Domain d5wydd_: 5wyd D: [348290] automated match to d2ppya_ complexed with ipa, mpd, mrd, ptd |
PDB Entry: 5wyd (more details), 2.1 Å
SCOPe Domain Sequences for d5wydd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wydd_ c.14.1.0 (D:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]} kassfddthkltvekhghtalitinhppantwdrdsliglrqliehlnrdddiyalvvtg qgpkffsagadlnmfadgdkararemarrfgeafealrdfrgvsiaaingyamgggleca lacdiriaerqaqmalpeaavgllpcaggtqalpwlvgegwakrmilcnervdaetalri glveqvvdsgeargaalllaakvarqspvairtikpliqgarerapntwlpeererfvdl fdaqdtregvnaflekrdpkwr
Timeline for d5wydd_: