Lineage for d5wydd_ (5wyd D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853595Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2853596Protein automated matches [190246] (71 species)
    not a true protein
  7. 2854174Species Pseudomonas aeruginosa [TaxId:208964] [348264] (5 PDB entries)
  8. 2854185Domain d5wydd_: 5wyd D: [348290]
    automated match to d2ppya_
    complexed with ipa, mpd, mrd, ptd

Details for d5wydd_

PDB Entry: 5wyd (more details), 2.1 Å

PDB Description: structural of pseudomonas aeruginosa dspi
PDB Compounds: (D:) Probable enoyl-CoA hydratase/isomerase

SCOPe Domain Sequences for d5wydd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wydd_ c.14.1.0 (D:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
kassfddthkltvekhghtalitinhppantwdrdsliglrqliehlnrdddiyalvvtg
qgpkffsagadlnmfadgdkararemarrfgeafealrdfrgvsiaaingyamgggleca
lacdiriaerqaqmalpeaavgllpcaggtqalpwlvgegwakrmilcnervdaetalri
glveqvvdsgeargaalllaakvarqspvairtikpliqgarerapntwlpeererfvdl
fdaqdtregvnaflekrdpkwr

SCOPe Domain Coordinates for d5wydd_:

Click to download the PDB-style file with coordinates for d5wydd_.
(The format of our PDB-style files is described here.)

Timeline for d5wydd_: