Class a: All alpha proteins [46456] (290 folds) |
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) |
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) automatically mapped to Pfam PF00068 |
Protein automated matches [190139] (27 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [260458] (12 PDB entries) |
Domain d5wzua_: 5wzu A: [348289] automated match to d3u8da_ complexed with 7w3, ca, cl, dms, gol |
PDB Entry: 5wzu (more details), 2.2 Å
SCOPe Domain Sequences for d5wzua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wzua_ a.133.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} nlvqfgvmiekmtgksalqyndygcycgiggshwpvdqtdwcchahdccygrleklgcep klekylfsvsergifcagrttcqrltcecdkraalcfrrnlgtynrkyahypnklctgpt ppc
Timeline for d5wzua_: