Lineage for d5wzua_ (5wzu A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732915Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2732916Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2732921Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2733305Protein automated matches [190139] (27 species)
    not a true protein
  7. 2733424Species Human (Homo sapiens) [TaxId:9606] [260458] (12 PDB entries)
  8. 2733435Domain d5wzua_: 5wzu A: [348289]
    automated match to d3u8da_
    complexed with 7w3, ca, cl, dms, gol

Details for d5wzua_

PDB Entry: 5wzu (more details), 2.2 Å

PDB Description: crystal structure of human secreted phospholipase a2 group iie with compound 24
PDB Compounds: (A:) Group IIE secretory phospholipase A2

SCOPe Domain Sequences for d5wzua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wzua_ a.133.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nlvqfgvmiekmtgksalqyndygcycgiggshwpvdqtdwcchahdccygrleklgcep
klekylfsvsergifcagrttcqrltcecdkraalcfrrnlgtynrkyahypnklctgpt
ppc

SCOPe Domain Coordinates for d5wzua_:

Click to download the PDB-style file with coordinates for d5wzua_.
(The format of our PDB-style files is described here.)

Timeline for d5wzua_: