SCOPe 2.08: Domain d5wzea2: 5wze A:177-442

Lineage for d5wzea2 (5wze A:177-442)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
   duplication: composed of two very similar alpha+beta folds

4. Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families)

5. Family d.127.1.0: automated matches [194833] (1 protein)
   not a true family

6. Protein automated matches [194834] (4 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:208964] [348286] (1 PDB entry)

8. Domain d5wzea2: 5wze A:177-442 [348287]
   Other proteins in same PDB: d5wzea1, d5wzec1, d5wzed1
   automated match to d1wl9a2
   complexed with ala, ca, edo, gol, mn, na, pge, pro, so4

Details for d5wzea2

PDB Entry: 5wze, 1.78 Å

PDB Description: the structure of pseudomonas aeruginosa aminopeptidase pepp

PDB Compounds: (A:) aminopeptidase p

SCOPe Domain Sequences for d5wzea2:

Sequence; same for both SEQRES and ATOM records:

>d5wzea2 d.127.1.0 (A:177-442) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
sanevkvmryaaevsarahiramevcrpglfeyhleaeleyefrkggakmpaygsivaag
rnacilhyrendaaikdgdlilidagceidcyasditrtfpangrfspeqkaiyelvlea
nmaafdyiapgrhwneaheatvrvitaglvrlgllegdvdeliaheaykafymhraghwl
gmdvhdvgeyrvggewrvlepgmamtvepgiyiapdnttvakkwrgigvrieddvvvtrn
gcevltngvpktvaeiealmaaakse

Timeline for d5wzea2:

• d5wzea2 first appeared in SCOPe 2.07