Class a: All alpha proteins [46456] (290 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein automated matches [190359] (43 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188371] (10 PDB entries) |
Domain d5woga_: 5wog A: [348257] Other proteins in same PDB: d5wogc_, d5wogd_ automated match to d1baba_ complexed with hem |
PDB Entry: 5wog (more details), 1.54 Å
SCOPe Domain Sequences for d5woga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5woga_ a.1.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgkk vadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpav hasldkflasvstvlts
Timeline for d5woga_: