Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) |
Family d.73.1.0: automated matches [336551] (1 protein) not a true family |
Protein automated matches [336552] (9 species) not a true protein |
Species Wheat (Triticum aestivum) [TaxId:4565] [348229] (1 PDB entry) |
Domain d5wskg_: 5wsk G: [348230] Other proteins in same PDB: d5wska1, d5wska2, d5wskb1, d5wskb2, d5wskc1, d5wskc2, d5wskd1, d5wskd2 automated match to d1ir21_ complexed with mg |
PDB Entry: 5wsk (more details), 1.78 Å
SCOPe Domain Sequences for d5wskg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wskg_ d.73.1.0 (G:) automated matches {Wheat (Triticum aestivum) [TaxId: 4565]} mqvwpiegikkfetlsylpplsteallkqvdylirskwvpclefskvgfifrehnaspgy ydgrywtmwklpmfgctdatqvineveevkkeypdayvriigfdnmrqvqcvsfiafkpp gc
Timeline for d5wskg_: