Lineage for d5wskg_ (5wsk G:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2957669Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 2957670Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) (S)
  5. 2957953Family d.73.1.0: automated matches [336551] (1 protein)
    not a true family
  6. 2957954Protein automated matches [336552] (9 species)
    not a true protein
  7. 2958007Species Wheat (Triticum aestivum) [TaxId:4565] [348229] (1 PDB entry)
  8. 2958010Domain d5wskg_: 5wsk G: [348230]
    Other proteins in same PDB: d5wska1, d5wska2, d5wskb1, d5wskb2, d5wskc1, d5wskc2, d5wskd1, d5wskd2
    automated match to d1ir21_
    complexed with mg

Details for d5wskg_

PDB Entry: 5wsk (more details), 1.78 Å

PDB Description: structure of ribulose-1,5-bisphosphate carboxylase/oxygenase from wheat
PDB Compounds: (G:) ribulose bisphosphate carboxylase small chain

SCOPe Domain Sequences for d5wskg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wskg_ d.73.1.0 (G:) automated matches {Wheat (Triticum aestivum) [TaxId: 4565]}
mqvwpiegikkfetlsylpplsteallkqvdylirskwvpclefskvgfifrehnaspgy
ydgrywtmwklpmfgctdatqvineveevkkeypdayvriigfdnmrqvqcvsfiafkpp
gc

SCOPe Domain Coordinates for d5wskg_:

Click to download the PDB-style file with coordinates for d5wskg_.
(The format of our PDB-style files is described here.)

Timeline for d5wskg_: