Lineage for d1ra2a_ (1ra2 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2903429Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2903430Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2903431Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 2903517Protein Dihydrofolate reductase, prokaryotic type [53599] (9 species)
  7. 2903533Species Escherichia coli [TaxId:562] [53600] (86 PDB entries)
  8. 2903548Domain d1ra2a_: 1ra2 A: [34821]
    complexed with fol, nap

Details for d1ra2a_

PDB Entry: 1ra2 (more details), 1.6 Å

PDB Description: dihydrofolate reductase complexed with folate and nicotinamide adenine dinucleotide phosphate (oxidized form)
PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d1ra2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ra2a_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Escherichia coli [TaxId: 562]}
misliaalavdrvigmenampwnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
gdthfpdyepddwesvfsefhdadaqnshsycfeilerr

SCOPe Domain Coordinates for d1ra2a_:

Click to download the PDB-style file with coordinates for d1ra2a_.
(The format of our PDB-style files is described here.)

Timeline for d1ra2a_: