Lineage for d5whia_ (5whi A:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021035Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 3021129Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 3021541Family f.1.4.0: automated matches [195065] (1 protein)
    not a true family
  6. 3021542Protein automated matches [195066] (5 species)
    not a true protein
  7. 3021546Species Human (Homo sapiens) [TaxId:9606] [225196] (14 PDB entries)
  8. 3021552Domain d5whia_: 5whi A: [348203]
    automated match to d2vm6a_
    complexed with cad

Details for d5whia_

PDB Entry: 5whi (more details), 1.69 Å

PDB Description: crystal structure of bcl-2-related protein a1
PDB Compounds: (A:) bcl-2-related protein a1

SCOPe Domain Sequences for d5whia_:

Sequence, based on SEQRES records: (download)

>d5whia_ f.1.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sefgyiyrlaqdylqsvlqipqpgsgpsktsrvlqnvafsvqkeveknlkscldnvnvvs
vdtartlfnqvmekefedgiinwgrivtifafegilikkllrqqiapdvdtykeisyfva
efimnntgewirqnggwengfvkkfepk

Sequence, based on observed residues (ATOM records): (download)

>d5whia_ f.1.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sefgyiyrlaqdylqsvlqipqsgpsktsrvlqnvafsvqkeveknlkscldnvnvvsvd
tartlfnqvmekefedgiinwgrivtifafegilikkllrqqiapdvdtykeisyfvaef
imnntgewirqnggwengfvkkfepk

SCOPe Domain Coordinates for d5whia_:

Click to download the PDB-style file with coordinates for d5whia_.
(The format of our PDB-style files is described here.)

Timeline for d5whia_: