Lineage for d5wi3a_ (5wi3 A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3014129Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 3014130Protein automated matches [190857] (70 species)
    not a true protein
  7. 3014276Species Acinetobacter sp. [TaxId:1182652] [348104] (3 PDB entries)
  8. 3014277Domain d5wi3a_: 5wi3 A: [348194]
    automated match to d4x55a_
    complexed with cef

Details for d5wi3a_

PDB Entry: 5wi3 (more details), 1.81 Å

PDB Description: structure of acinetobacter baumannii carbapenemase oxa-239 k82d bound to cefotaxime
PDB Compounds: (A:) oxa-239

SCOPe Domain Sequences for d5wi3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wi3a_ e.3.1.0 (A:) automated matches {Acinetobacter sp. [TaxId: 1182652]}
qivqghnqvihqyfdekntsgvlviqtdkkinlygnalsranteyvpastfdmlnaligl
enqktdineifkwkgekrlftawekdmtlgeamklsavpvyqelarrigldlmqkevkri
gfgnaeigqqvdnfwlvgplkvtpiqevefvsqlahtqlpfsekvqanvknmllleesng
ykifgktgwamniksqvgwltgwveqpdgkivafalnmemrsempasirnellmkslkql
nii

SCOPe Domain Coordinates for d5wi3a_:

Click to download the PDB-style file with coordinates for d5wi3a_.
(The format of our PDB-style files is described here.)

Timeline for d5wi3a_: