Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.0: automated matches [191512] (1 protein) not a true family |
Protein automated matches [190857] (70 species) not a true protein |
Species Acinetobacter sp. [TaxId:1182652] [348104] (3 PDB entries) |
Domain d5wi3a_: 5wi3 A: [348194] automated match to d4x55a_ complexed with cef |
PDB Entry: 5wi3 (more details), 1.81 Å
SCOPe Domain Sequences for d5wi3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wi3a_ e.3.1.0 (A:) automated matches {Acinetobacter sp. [TaxId: 1182652]} qivqghnqvihqyfdekntsgvlviqtdkkinlygnalsranteyvpastfdmlnaligl enqktdineifkwkgekrlftawekdmtlgeamklsavpvyqelarrigldlmqkevkri gfgnaeigqqvdnfwlvgplkvtpiqevefvsqlahtqlpfsekvqanvknmllleesng ykifgktgwamniksqvgwltgwveqpdgkivafalnmemrsempasirnellmkslkql nii
Timeline for d5wi3a_: