SCOPe 2.08: Domain d5wg3a3: 5wg3 A:551-668

Lineage for d5wg3a3 (5wg3 A:551-668)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.0: automated matches [191311] (1 protein)
   not a true family

6. Protein automated matches [190052] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186914] (120 PDB entries)

8. Domain d5wg3a3: 5wg3 A:551-668 [348192]
   Other proteins in same PDB: d5wg3a1, d5wg3a2, d5wg3b_, d5wg3g_
   automated match to d3krwa3
   complexed with afm, mg

Details for d5wg3a3

PDB Entry: 5wg3, 2.9 Å

PDB Description: human grk2 in complex with gbetagamma subunits and ccg258748

PDB Compounds: (A:) Beta-adrenergic receptor kinase 1

SCOPe Domain Sequences for d5wg3a3:

Sequence, based on SEQRES records:

>d5wg3a3 b.55.1.0 (A:551-668) automated matches {Human (Homo sapiens) [TaxId: 9606]}
edyalgkdcimhgymskmgnpfltqwqrryfylfpnrlewrgegeapqslltmeeiqsve
etqikerkclllkirggkqfilqcdsdpelvqwkkelrdayreaqqlvqrvpkmknkp

Sequence, based on observed residues (ATOM records):

>d5wg3a3 b.55.1.0 (A:551-668) automated matches {Human (Homo sapiens) [TaxId: 9606]}
edyalgkdcimhgymskmgnpfltqwqrryfylfpnrlewrgeapqslltmeeiqsveet
qikerkclllkirggkqfilqcdsdpelvqwkkelrdayreaqqlvqrvpkmknkp

Timeline for d5wg3a3:

• d5wg3a3 first appeared in SCOPe 2.07