Class b: All beta proteins [48724] (180 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
Protein automated matches [190291] (19 species) not a true protein |
Species Influenza a virus (a/texas/50/2012(h3n2)) [TaxId:1321009] [347902] (3 PDB entries) |
Domain d5w08d_: 5w08 D: [348169] Other proteins in same PDB: d5w08g_, d5w08h1, d5w08h2, d5w08i_, d5w08j1, d5w08j2, d5w08k_, d5w08l1, d5w08l2, d5w08m_, d5w08n1, d5w08n2, d5w08o_, d5w08p1, d5w08p2, d5w08q_, d5w08r1, d5w08r2 automated match to d5umna_ complexed with gol, nag |
PDB Entry: 5w08 (more details), 2.6 Å
SCOPe Domain Sequences for d5w08d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5w08d_ b.19.1.2 (D:) automated matches {Influenza a virus (a/texas/50/2012(h3n2)) [TaxId: 1321009]} telvqnssigeicdsphqildgenctlidallgdpqcdgfqnkkwdlfverskaysncyp ydvpdyaslrslvassgtlefnnesfnwngvtqngtssacirrsnnsffsrlnwlthlnf kypalnvtmpnneqfdklyiwgvhhpvtdkdqiflyaqpsgritvstkrsqqavipnigf rprirnipsrisiywtivkpgdillinstgnliaprgyfkirsgkssimrsdapigkcks ecitpngsipndkpfqnvnritygacpryvkqs
Timeline for d5w08d_: