SCOPe 2.08: Domain d5w0dc1: 5w0d C:2-109

Lineage for d5w0dc1 (5w0d C:2-109)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5w0dc1: 5w0d C:2-109 [348144]
   Other proteins in same PDB: d5w0dc2
   automated match to d1aqkl1
   complexed with gol, mes

Details for d5w0dc1

PDB Entry: 5w0d, 1.9 Å

PDB Description: inferred precursor (uca) of the human antibody lineage k03.12 in complex with influenza hemagglutinin h1 solomon islands/03/2006

PDB Compounds: (C:) Lineage K03.12 UCA antibody light chain

SCOPe Domain Sequences for d5w0dc1:

Sequence, based on SEQRES records:

>d5w0dc1 b.1.1.0 (C:2-109) automated matches {Human (Homo sapiens) [TaxId: 9606]}
saltqpasvsgspgqsitisctgtssdvgsynlvswyqqhpgkapklmiyegskrpsgvs
nrfsgsksgntasltisglqaedeadyyccsyagsvvfgggtkltvlg

Sequence, based on observed residues (ATOM records):

>d5w0dc1 b.1.1.0 (C:2-109) automated matches {Human (Homo sapiens) [TaxId: 9606]}
saltqpasvsgspgqsitisctgnlvswyqqhpgkapklmiyegskrpsgvsnrfsgsks
gntasltisglqaedeadyyccsyagsvvfgggtkltvlg

Timeline for d5w0dc1:

• d5w0dc1 first appeared in SCOPe 2.07