SCOPe 2.06: Domain d1dwqa1: 1dwq A:2-258

Lineage for d1dwqa1 (1dwq A:2-258)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.20: Hydroxynitrile lyase-like [53585] (3 proteins)
   automatically mapped to Pfam PF12697

6. Protein Hydroxynitrile lyase [53586] (2 species)

7. Species Cassava (Manihot esculenta) [TaxId:3983] [53588] (11 PDB entries)

8. Domain d1dwqa1: 1dwq A:2-258 [34808]
   Other proteins in same PDB: d1dwqa2, d1dwqb2
   complexed with ato

Details for d1dwqa1

PDB Entry: 1dwq, 2.2 Å

PDB Description: crystal structure of hydroxynitrile lyase from manihot esculenta in complex with substrates acetone and chloroacetone:implications for the mechanism of cyanogenesis

PDB Compounds: (A:) hydroxynitrile lyase

SCOPe Domain Sequences for d1dwqa1:

Sequence; same for both SEQRES and ATOM records:

>d1dwqa1 c.69.1.20 (A:2-258) Hydroxynitrile lyase {Cassava (Manihot esculenta) [TaxId: 3983]}
vtahfvlihtichgawiwhklkpaleraghkvtaldmaasgidprqieqinsfdeysepl
ltfleklpqgekviivgescaglniaiaadryvdkiaagvfhnsllpdtvhspsytvekl
lesfpdwrdteyftftnitgetittmklgfvllrenlftkctdgeyelakmvmrkgslfq
nvlaqrpkftekgygsikkvyiwtdqdkiflpdfqrwqianykpdkvyqvqggdhklqlt
kteevahilqevadaya

Timeline for d1dwqa1:

• d1dwqa1 first appeared (with stable ids) in SCOP 1.55, called d1dwqa_
  
• d1dwqa1 was called d1dwqa_ in SCOPe 2.05
  
• d1dwqa1 appears in SCOPe 2.07
  
• d1dwqa1 appears in the current release, SCOPe 2.08