SCOPe 2.08: Domain d5vrkb_: 5vrk B:

Lineage for d5vrkb_ (5vrk B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.0: automated matches [191327] (1 protein)
   not a true family

6. Protein automated matches [190150] (36 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:2287] [188418] (16 PDB entries)

8. Domain d5vrkb_: 5vrk B: [348059]
   automated match to d5vria_
   complexed with co, edo, fe, gol; mutant

Details for d5vrkb_

PDB Entry: 5vrk, 1.4 Å

PDB Description: crystal structure of ssopox asa6 mutant (f46l-c258a-w263m-i280t) - open form

PDB Compounds: (B:) aryldialkylphosphatase

SCOPe Domain Sequences for d5vrkb_:

Sequence; same for both SEQRES and ATOM records:

>d5vrkb_ c.1.9.0 (B:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
mriplvgkdsieskdigftlihehlrvfseavrqqwphlynedeelrnavnevkramqfg
vktivdptvmglgrdirfmekvvkatginlvagtgiyiyidlpfyflnrsideiadlfih
dikegiqgtlnkagfvkiaadepgitkdvekviraaaianketkvpiithsnahnntgle
qqrilteegvdpgkilighlgdtdnidyikkiadkgsfigldrygldlflpvdkrnettl
rlikdgysdkimishdyactidmgtakpeykpklaprwsttlifedtipflkrngvneev
iatifkenpkkffs

Timeline for d5vrkb_:

• d5vrkb_ first appeared in SCOPe 2.07