Lineage for d5wcza2 (5wcz A:483-561)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2400339Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2400340Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2400933Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 2400934Protein automated matches [226835] (38 species)
    not a true protein
  7. 2400960Species Bacillus subtilis [TaxId:224308] [228101] (5 PDB entries)
  8. 3047991Domain d5wcza2: 5wcz A:483-561 [348053]
    Other proteins in same PDB: d5wcza1, d5wczb1
    automated match to d4m8ua2
    complexed with gol, noj

Details for d5wcza2

PDB Entry: 5wcz (more details), 1.58 Å

PDB Description: crystal structure of wild-type mall from bacillus subtilis with ts analogue 1-deoxynojirimycin
PDB Compounds: (A:) Oligo-1,6-glucosidase 1

SCOPe Domain Sequences for d5wcza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wcza2 b.71.1.0 (A:483-561) automated matches {Bacillus subtilis [TaxId: 224308]}
gdyqllqendpqvfsylreyrgekllvvvnlseekalfeappeliherwkvlisnypqer
adlksislkpyeavmgisi

SCOPe Domain Coordinates for d5wcza2:

Click to download the PDB-style file with coordinates for d5wcza2.
(The format of our PDB-style files is described here.)

Timeline for d5wcza2:

  • d5wcza2 appears in periodic updates to SCOPe 2.07 starting on 2018-04-06

View in 3D
Domains from same chain:
(mouse over for more information)
d5wcza1