Lineage for d5wcza1 (5wcz A:3-482)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2416558Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2416559Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2417057Protein automated matches [190099] (29 species)
    not a true protein
  7. 2417069Species Bacillus subtilis [TaxId:224308] [228099] (5 PDB entries)
  8. 3047990Domain d5wcza1: 5wcz A:3-482 [348052]
    Other proteins in same PDB: d5wcza2, d5wczb2
    automated match to d4m8ua1
    complexed with gol, noj

Details for d5wcza1

PDB Entry: 5wcz (more details), 1.58 Å

PDB Description: crystal structure of wild-type mall from bacillus subtilis with ts analogue 1-deoxynojirimycin
PDB Compounds: (A:) Oligo-1,6-glucosidase 1

SCOPe Domain Sequences for d5wcza1:

Sequence, based on SEQRES records: (download)

>d5wcza1 c.1.8.1 (A:3-482) automated matches {Bacillus subtilis [TaxId: 224308]}
ewwkeavvyqiyprsfydangdgfgdlqgviqkldyiknlgadviwlspvfdspqddngy
disdyknmyekfgtnedmfqlidevhkrgmkivmdlvvnhtsdehawfaesrkskdnpyr
dyylwkdpkpdgsepnnwgsifsgsawtydegtgqyylhyfskkqpdlnweneavrrevy
dvmrfwmdrgvdgwrmdvigsiskytdfpdyetdhsrsyivgryhsngprlhefiqemnr
evlshydcmtvgeangsdieeakkytdasrqelnmiftfehmdidkeqnspngkwqikpf
dlialkktmtrwqtglmnvgwntlyfenhdqprvisrwgndrklrkecakafatvlhgmk
gtpfiyqgeeigmvnsdmplemyddleiknayrelvvenktmsekefvkavmikgrdhar
tpmqwdagkhagftagdpwipvnsryqdinvkesledqdsiffyyqkliqlrkqykimiy

Sequence, based on observed residues (ATOM records): (download)

>d5wcza1 c.1.8.1 (A:3-482) automated matches {Bacillus subtilis [TaxId: 224308]}
ewwkeavvyqiyprsfydangdgfgdlqgviqkldyiknlgadviwlspvfdspqddngy
disdyknmyekfgtnedmfqlidevhkrgmkivmdlvvnhtsdehawfaesrkskdnpyr
dyylwkdpkpdgsepnnwgsifsgsawtydegtgqyylhyfskkqpdlnweneavrrevy
dvmrfwmdrgvdgwrmdvigsiskytdfpdyetrsyivgryhsngprlhefiqemnrevl
shydcmtvgeangsdieeakkytdasrqelnmiftfehmdidkeqnspngkwqikpfdli
alkktmtrwqtglmnvgwntlyfenhdqprvisrwgndrklrkecakafatvlhgmkgtp
fiyqgeeigmvnsdmplemyddleiknayrelvvenktmsekefvkavmikgrdhartpm
qwdagkhagftagdpwipvnsryqdinvkesledqdsiffyyqkliqlrkqykimiy

SCOPe Domain Coordinates for d5wcza1:

Click to download the PDB-style file with coordinates for d5wcza1.
(The format of our PDB-style files is described here.)

Timeline for d5wcza1:

  • d5wcza1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-06

View in 3D
Domains from same chain:
(mouse over for more information)
d5wcza2