Class b: All beta proteins [48724] (180 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
Protein automated matches [226835] (41 species) not a true protein |
Species Bacillus subtilis [TaxId:224308] [228101] (5 PDB entries) |
Domain d5wczb2: 5wcz B:483-561 [348004] Other proteins in same PDB: d5wcza1, d5wczb1 automated match to d4m8ua2 complexed with gol, noj |
PDB Entry: 5wcz (more details), 1.58 Å
SCOPe Domain Sequences for d5wczb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wczb2 b.71.1.0 (B:483-561) automated matches {Bacillus subtilis [TaxId: 224308]} gdyqllqendpqvfsylreyrgekllvvvnlseekalfeappeliherwkvlisnypqer adlksislkpyeavmgisi
Timeline for d5wczb2: