Lineage for d7yasa_ (7yas A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 841866Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 841867Superfamily c.69.1: alpha/beta-Hydrolases [53474] (41 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 842582Family c.69.1.20: Hydroxynitrile lyase-like [53585] (2 proteins)
  6. 842583Protein Hydroxynitrile lyase [53586] (2 species)
  7. 842599Species Rubber tree (Hevea brasiliensis) [TaxId:3981] [53587] (19 PDB entries)
    Uniprot P52704
  8. 842611Domain d7yasa_: 7yas A: [34798]
    complexed with epe, gol, so4

Details for d7yasa_

PDB Entry: 7yas (more details), 1.75 Å

PDB Description: hydroxynitrile lyase, low temperature native structure
PDB Compounds: (A:) protein (hydroxynitrile lyase)

SCOP Domain Sequences for d7yasa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7yasa_ c.69.1.20 (A:) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]}
afahfvlihtichgawiwhklkpllealghkvtaldlaasgvdprqieeigsfdeysepl
ltflealppgekvilvgescgglniaiaadkycekiaaavfhnsvlpdtehcpsyvvdkl
mevfpdwkdttyftytkdgkeitglklgftllrenlytlcgpeeyelakmltrkgslfqn
ilakrpfftkegygsikkiyvwtdqdeiflpefqlwqienykpdkvykveggdhklqltk
tkeiaeilqevadtyn

SCOP Domain Coordinates for d7yasa_:

Click to download the PDB-style file with coordinates for d7yasa_.
(The format of our PDB-style files is described here.)

Timeline for d7yasa_: